Lineage for d2gcqa_ (2gcq A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111791Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 protein domains)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2112083Protein automated matches [190304] (11 species)
    not a true protein
  7. 2112093Species Escherichia coli [TaxId:562] [187113] (1 PDB entry)
  8. 2112094Domain d2gcqa_: 2gcq A: [134993]
    automated match to d1adea_
    complexed with doi, gdp, hda, mg

Details for d2gcqa_

PDB Entry: 2gcq (more details), 2 Å

PDB Description: Fully ligated E.Coli Adenylosuccinate Synthetase with GTP, 2'-deoxy-IMP and Hadacidin
PDB Compounds: (A:) adenylosuccinate synthetase

SCOPe Domain Sequences for d2gcqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gcqa_ c.37.1.10 (A:) automated matches {Escherichia coli [TaxId: 562]}
gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
tgrrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
etmilrdpfda

SCOPe Domain Coordinates for d2gcqa_:

Click to download the PDB-style file with coordinates for d2gcqa_.
(The format of our PDB-style files is described here.)

Timeline for d2gcqa_: