SCOPe 2.08: Domain d2gcqa_: 2gcq A:

Lineage for d2gcqa_ (2gcq A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein automated matches [190304] (16 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187113] (3 PDB entries)

8. Domain d2gcqa_: 2gcq A: [134993]
   automated match to d1adea_
   complexed with doi, gdp, hda, mg

Details for d2gcqa_

PDB Entry: 2gcq, 2 Å

PDB Description: Fully ligated E.Coli Adenylosuccinate Synthetase with GTP, 2'-deoxy-IMP and Hadacidin

PDB Compounds: (A:) adenylosuccinate synthetase

SCOPe Domain Sequences for d2gcqa_:

Sequence; same for both SEQRES and ATOM records:

>d2gcqa_ c.37.1.10 (A:) automated matches {Escherichia coli [TaxId: 562]}
gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
tgrrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
etmilrdpfda

Timeline for d2gcqa_:

• d2gcqa_ first appeared in SCOP 1.73, called d2gcqa1
  
• d2gcqa_ appears in SCOPe 2.07