![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.10: SSRP1-like [141436] (2 proteins) Pfam PF03531; Structure-specific recognition protein family; duplication: comprises tandem repeat of two domains of this fold |
![]() | Protein automated matches [190657] (2 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187743] (1 PDB entry) |
![]() | Domain d2gclb_: 2gcl B: [134992] Other proteins in same PDB: d2gcla1 automated match to d2gcla1 complexed with cl |
PDB Entry: 2gcl (more details), 2.21 Å
SCOPe Domain Sequences for d2gclb_:
Sequence, based on SEQRES records: (download)
>d2gclb_ b.55.1.10 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhm mvmaiepplrqgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv smvnisragqtstssrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkne
>d2gclb_ b.55.1.10 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhm mvmaiepplrqgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv smvnisrartfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkne
Timeline for d2gclb_: