SCOPe 2.08: Domain d2gclb_: 2gcl B:

Lineage for d2gclb_ (2gcl B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.10: SSRP1-like [141436] (2 proteins)
   Pfam PF03531; Structure-specific recognition protein family; duplication: comprises tandem repeat of two domains of this fold

6. Protein automated matches [190657] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187743] (1 PDB entry)

8. Domain d2gclb_: 2gcl B: [134992]
   Other proteins in same PDB: d2gcla1
   automated match to d2gcla1
   complexed with cl

Details for d2gclb_

PDB Entry: 2gcl, 2.21 Å

PDB Description: structure of the pob3 middle domain

PDB Compounds: (B:) Hypothetical 63.0 kDa protein in DAK1-ORC1 intergenic region

SCOPe Domain Sequences for d2gclb_:

Sequence, based on SEQRES records:

>d2gclb_ b.55.1.10 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhm
mvmaiepplrqgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl
shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv
smvnisragqtstssrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkne

Sequence, based on observed residues (ATOM records):

>d2gclb_ b.55.1.10 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhm
mvmaiepplrqgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl
shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv
smvnisrartfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkne

Timeline for d2gclb_:

• d2gclb_ first appeared in SCOP 1.73, called d2gclb1
  
• d2gclb_ appears in SCOPe 2.07