SCOP 1.75: Domain d2gcjd1: 2gcj D:238-474

Lineage for d2gcjd1 (2gcj D:238-474)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (13 families)

5. Family b.55.1.10: SSRP1-like [141436] (1 protein)
   Pfam PF03531; Structure-specific recognition protein family; duplication: comprises tandem repeat of two domains of this fold

6. Protein FACT complex subunit POB3, middle domain [141437] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141438] (2 PDB entries)
   Uniprot Q04636 237-474! Uniprot Q04636 238-474

8. Domain d2gcjd1: 2gcj D:238-474 [134990]
   automatically matched to 2GCJ A:238-474
   mutant

Details for d2gcjd1

PDB Entry: 2gcj, 2.55 Å

PDB Description: crystal structure of the pob3 middle domain

PDB Compounds: (D:) Hypothetical 63.0 kDa protein in DAK1-ORC1 intergenic region

SCOP Domain Sequences for d2gcjd1:

Sequence, based on SEQRES records:

>d2gcjd1 b.55.1.10 (D:238-474) FACT complex subunit POB3, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhl
lvlaiepplrkgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl
shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv
smvnisragqtstssrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkn

Sequence, based on observed residues (ATOM records):

>d2gcjd1 b.55.1.10 (D:238-474) FACT complex subunit POB3, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhl
lvlaiepplrkgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl
shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv
smvnisrrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkn

Timeline for d2gcjd1:

• d2gcjd1 first appeared in SCOP 1.73
  
• d2gcjd1 appears in SCOPe 2.01
  
• d2gcjd1 appears in the current release, SCOPe 2.08, called d2gcjd_