Lineage for d2gcjc1 (2gcj C:238-474)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805150Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 805151Superfamily b.55.1: PH domain-like [50729] (13 families) (S)
  5. 805621Family b.55.1.10: SSRP1-like [141436] (1 protein)
    Pfam PF03531; Structure-specific recognition protein family; duplication: comprises tandem repeat of two domains of this fold
  6. 805622Protein FACT complex subunit POB3, middle domain [141437] (1 species)
  7. 805623Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141438] (2 PDB entries)
    Uniprot Q04636 237-474! Uniprot Q04636 238-474
  8. 805628Domain d2gcjc1: 2gcj C:238-474 [134989]
    automatically matched to 2GCJ A:238-474
    mutant

Details for d2gcjc1

PDB Entry: 2gcj (more details), 2.55 Å

PDB Description: crystal structure of the pob3 middle domain
PDB Compounds: (C:) Hypothetical 63.0 kDa protein in DAK1-ORC1 intergenic region

SCOP Domain Sequences for d2gcjc1:

Sequence, based on SEQRES records: (download)

>d2gcjc1 b.55.1.10 (C:238-474) FACT complex subunit POB3, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhl
lvlaiepplrkgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl
shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv
smvnisragqtstssrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkn

Sequence, based on observed residues (ATOM records): (download)

>d2gcjc1 b.55.1.10 (C:238-474) FACT complex subunit POB3, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhl
lvlaiepplrkgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl
shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv
smvnisrrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkn

SCOP Domain Coordinates for d2gcjc1:

Click to download the PDB-style file with coordinates for d2gcjc1.
(The format of our PDB-style files is described here.)

Timeline for d2gcjc1: