Lineage for d2gcjb1 (2gcj B:238-474)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 673424Family b.55.1.10: SSRP1-like [141436] (1 protein)
    Pfam PF03531; Structure-specific recognition protein family; duplication: comprises tandem repeat of two domains of this fold
  6. 673425Protein FACT complex subunit POB3, middle domain [141437] (1 species)
  7. 673426Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141438] (2 PDB entries)
  8. 673430Domain d2gcjb1: 2gcj B:238-474 [134988]
    automatically matched to 2GCJ A:238-474
    mutant

Details for d2gcjb1

PDB Entry: 2gcj (more details), 2.55 Å

PDB Description: crystal structure of the pob3 middle domain
PDB Compounds: (B:) Hypothetical 63.0 kDa protein in DAK1-ORC1 intergenic region

SCOP Domain Sequences for d2gcjb1:

Sequence, based on SEQRES records: (download)

>d2gcjb1 b.55.1.10 (B:238-474) FACT complex subunit POB3, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhl
lvlaiepplrkgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl
shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv
smvnisragqtstssrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkn

Sequence, based on observed residues (ATOM records): (download)

>d2gcjb1 b.55.1.10 (B:238-474) FACT complex subunit POB3, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhl
lvlaiepplrkgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl
shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv
smvnisrrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkn

SCOP Domain Coordinates for d2gcjb1:

Click to download the PDB-style file with coordinates for d2gcjb1.
(The format of our PDB-style files is described here.)

Timeline for d2gcjb1: