Class b: All beta proteins [48724] (165 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (12 families) |
Family b.55.1.10: SSRP1-like [141436] (1 protein) Pfam PF03531; Structure-specific recognition protein family; duplication: comprises tandem repeat of two domains of this fold |
Protein FACT complex subunit POB3, middle domain [141437] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141438] (2 PDB entries) |
Domain d2gcjb1: 2gcj B:238-474 [134988] automatically matched to 2GCJ A:238-474 mutant |
PDB Entry: 2gcj (more details), 2.55 Å
SCOP Domain Sequences for d2gcjb1:
Sequence, based on SEQRES records: (download)
>d2gcjb1 b.55.1.10 (B:238-474) FACT complex subunit POB3, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhl lvlaiepplrkgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv smvnisragqtstssrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkn
>d2gcjb1 b.55.1.10 (B:238-474) FACT complex subunit POB3, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhl lvlaiepplrkgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv smvnisrrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkn
Timeline for d2gcjb1: