![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Serine/threonine protein kinase TAO2 [118127] (1 species) OPK group; serine/threonine kinase |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [118128] (3 PDB entries) Uniprot Q9JLS3 12-320 |
![]() | Domain d2gcdb_: 2gcd B: [134978] automated match to d1u5qa_ complexed with stu |
PDB Entry: 2gcd (more details), 2.55 Å
SCOPe Domain Sequences for d2gcdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gcdb_ d.144.1.7 (B:) Serine/threonine protein kinase TAO2 {Norway rat (Rattus norvegicus) [TaxId: 10116]} dpdvaelffkddpeklfsdlreighgsfgavyfardvrnsevvaikkmsysgkqsnekwq diikevrflqklrhpntiqyrgcylrehtawlvmeyclgsasdllevhkkplqeveiaav thgalqglaylhshnmihrdvkagnillsepglvklgdfgsasimapansfvgtpywmap evilamdegqydgkvdvwslgitcielaerkpplfnmnamsalyhiaqnespalqsghws eyfrnfvdsclqkipqdrptsevllkhrfvlrerpptvimdliqrtkdavreldnlqyrk mkkilfqea
Timeline for d2gcdb_: