Lineage for d2gcdb_ (2gcd B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1435443Protein Serine/threonine protein kinase TAO2 [118127] (1 species)
    OPK group; serine/threonine kinase
  7. 1435444Species Norway rat (Rattus norvegicus) [TaxId:10116] [118128] (3 PDB entries)
    Uniprot Q9JLS3 12-320
  8. 1435450Domain d2gcdb_: 2gcd B: [134978]
    automated match to d1u5qa_
    complexed with stu

Details for d2gcdb_

PDB Entry: 2gcd (more details), 2.55 Å

PDB Description: tao2 kinase domain-staurosporine structure
PDB Compounds: (B:) Serine/threonine-protein kinase TAO2

SCOPe Domain Sequences for d2gcdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gcdb_ d.144.1.7 (B:) Serine/threonine protein kinase TAO2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dpdvaelffkddpeklfsdlreighgsfgavyfardvrnsevvaikkmsysgkqsnekwq
diikevrflqklrhpntiqyrgcylrehtawlvmeyclgsasdllevhkkplqeveiaav
thgalqglaylhshnmihrdvkagnillsepglvklgdfgsasimapansfvgtpywmap
evilamdegqydgkvdvwslgitcielaerkpplfnmnamsalyhiaqnespalqsghws
eyfrnfvdsclqkipqdrptsevllkhrfvlrerpptvimdliqrtkdavreldnlqyrk
mkkilfqea

SCOPe Domain Coordinates for d2gcdb_:

Click to download the PDB-style file with coordinates for d2gcdb_.
(The format of our PDB-style files is described here.)

Timeline for d2gcdb_: