SCOP 1.73: Domain d2gcdb1: 2gcd B:12-320

Lineage for d2gcdb1 (2gcd B:12-320)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Serine/threonine protein kinase TAO2 [118127] (1 species)
   OPK group; serine/threonine kinase

7. Species Rat (Rattus norvegicus) [TaxId:10116] [118128] (3 PDB entries)

8. Domain d2gcdb1: 2gcd B:12-320 [134978]
   automatically matched to d1u5qa_
   complexed with stu

Details for d2gcdb1

PDB Entry: 2gcd, 2.55 Å

PDB Description: tao2 kinase domain-staurosporine structure

PDB Compounds: (B:) Serine/threonine-protein kinase TAO2

SCOP Domain Sequences for d2gcdb1:

Sequence; same for both SEQRES and ATOM records:

>d2gcdb1 d.144.1.7 (B:12-320) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]}
dpdvaelffkddpeklfsdlreighgsfgavyfardvrnsevvaikkmsysgkqsnekwq
diikevrflqklrhpntiqyrgcylrehtawlvmeyclgsasdllevhkkplqeveiaav
thgalqglaylhshnmihrdvkagnillsepglvklgdfgsasimapansfvgtpywmap
evilamdegqydgkvdvwslgitcielaerkpplfnmnamsalyhiaqnespalqsghws
eyfrnfvdsclqkipqdrptsevllkhrfvlrerpptvimdliqrtkdavreldnlqyrk
mkkilfqea

Timeline for d2gcdb1:

• d2gcdb1 is new in SCOP 1.73
  
• d2gcdb1 appears in SCOP 1.75
  
• d2gcdb1 appears in the current release, SCOPe 2.08, called d2gcdb_