SCOPe 2.08: Domain d2gcdb_: 2gcd B:

Lineage for d2gcdb_ (2gcd B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Serine/threonine protein kinase TAO2 [118127] (1 species)
   OPK group; serine/threonine kinase

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [118128] (3 PDB entries)
   Uniprot Q9JLS3 12-320

8. Domain d2gcdb_: 2gcd B: [134978]
   automated match to d1u5qa_
   complexed with stu

Details for d2gcdb_

PDB Entry: 2gcd, 2.55 Å

PDB Description: tao2 kinase domain-staurosporine structure

PDB Compounds: (B:) Serine/threonine-protein kinase TAO2

SCOPe Domain Sequences for d2gcdb_:

Sequence; same for both SEQRES and ATOM records:

>d2gcdb_ d.144.1.7 (B:) Serine/threonine protein kinase TAO2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dpdvaelffkddpeklfsdlreighgsfgavyfardvrnsevvaikkmsysgkqsnekwq
diikevrflqklrhpntiqyrgcylrehtawlvmeyclgsasdllevhkkplqeveiaav
thgalqglaylhshnmihrdvkagnillsepglvklgdfgsasimapansfvgtpywmap
evilamdegqydgkvdvwslgitcielaerkpplfnmnamsalyhiaqnespalqsghws
eyfrnfvdsclqkipqdrptsevllkhrfvlrerpptvimdliqrtkdavreldnlqyrk
mkkilfqea

Timeline for d2gcdb_:

• d2gcdb_ first appeared in SCOP 1.73, called d2gcdb1
  
• d2gcdb_ appears in SCOPe 2.07