SCOP 1.73: Domain d2gcba2: 2gcb A:1-296

Lineage for d2gcba2 (2gcb A:1-296)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (2 families)
   has extra strand located between strands 1 and 2

5. Family c.72.2.2: Folylpolyglutamate synthetase [53629] (1 protein)

6. Protein Folylpolyglutamate synthetase [53630] (2 species)

7. Species Lactobacillus casei [TaxId:1582] [53631] (7 PDB entries)

8. Domain d2gcba2: 2gcb A:1-296 [134976]
   Other proteins in same PDB: d2gcba1
   automatically matched to d1fgs_2
   mutant

Details for d2gcba2

PDB Entry: 2gcb, 2.3 Å

PDB Description: g51s/s52t double mutant of l. casei fpgs

PDB Compounds: (A:) Folylpolyglutamate synthase

SCOP Domain Sequences for d2gcba2:

Sequence; same for both SEQRES and ATOM records:

>d2gcba2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]}
mnytetvayihsfprlaktgdhrriltllhalgnpqqqgryihvtgtngkstaanaiahv
leasgltvglytspfimrfnerimidhepipdaalvnavafvraalerlqqqqadfnvte
fefitalgywyfrqrqvdvavievgiggdtdstnvitpvvsvltsvaldhqkllghtita
iakhkagiikrgipvvtgnlvpdaaavvaakvattgsqwlrfdrdfsvpkaklhgwgqrf
tyedqdgrisdlevplvgdyqqrnmaiaiqtakvyakqtewpltpqnirqglaash

Timeline for d2gcba2:

• d2gcba2 is new in SCOP 1.73
  
• d2gcba2 appears in SCOP 1.75
  
• d2gcba2 appears in the current release, SCOPe 2.08