Lineage for d2gcaa2 (2gca A:1-296)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1385058Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1385514Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (2 families) (S)
    has extra strand located between strands 1 and 2
  5. 1385549Family c.72.2.2: Folylpolyglutamate synthetase [53629] (1 protein)
  6. 1385550Protein Folylpolyglutamate synthetase [53630] (2 species)
  7. 1385551Species Lactobacillus casei [TaxId:1582] [53631] (7 PDB entries)
  8. 1385557Domain d2gcaa2: 2gca A:1-296 [134974]
    Other proteins in same PDB: d2gcaa1
    automatically matched to d1fgs_2

Details for d2gcaa2

PDB Entry: 2gca (more details), 2.4 Å

PDB Description: apo form of l. casei fpgs
PDB Compounds: (A:) Folylpolyglutamate synthase

SCOPe Domain Sequences for d2gcaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gcaa2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]}
mnytetvayihsfprlaktgdhrriltllhalgnpqqqgryihvtgtngkgsaanaiahv
leasgltvglytspfimrfnerimidhepipdaalvnavafvraalerlqqqqadfnvte
fefitalgywyfrqrqvdvavievgiggdtdstnvitpvvsvltevaldhqkllghtita
iakhkagiikrgipvvtgnlvpdaaavvaakvattgsqwlrfdrdfsvpkaklhgwgqrf
tyedqdgrisdlevplvgdyqqrnmaiaiqtakvyakqtewpltpqnirqglaash

SCOPe Domain Coordinates for d2gcaa2:

Click to download the PDB-style file with coordinates for d2gcaa2.
(The format of our PDB-style files is described here.)

Timeline for d2gcaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gcaa1