SCOP 1.75: Domain d2gcaa2: 2gca A:1-296

Lineage for d2gcaa2 (2gca A:1-296)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (2 families)
   has extra strand located between strands 1 and 2

5. Family c.72.2.2: Folylpolyglutamate synthetase [53629] (1 protein)

6. Protein Folylpolyglutamate synthetase [53630] (2 species)

7. Species Lactobacillus casei [TaxId:1582] [53631] (7 PDB entries)

8. Domain d2gcaa2: 2gca A:1-296 [134974]
   Other proteins in same PDB: d2gcaa1
   automatically matched to d1fgs_2

Details for d2gcaa2

PDB Entry: 2gca, 2.4 Å

PDB Description: apo form of l. casei fpgs

PDB Compounds: (A:) Folylpolyglutamate synthase

SCOP Domain Sequences for d2gcaa2:

Sequence; same for both SEQRES and ATOM records:

>d2gcaa2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]}
mnytetvayihsfprlaktgdhrriltllhalgnpqqqgryihvtgtngkgsaanaiahv
leasgltvglytspfimrfnerimidhepipdaalvnavafvraalerlqqqqadfnvte
fefitalgywyfrqrqvdvavievgiggdtdstnvitpvvsvltevaldhqkllghtita
iakhkagiikrgipvvtgnlvpdaaavvaakvattgsqwlrfdrdfsvpkaklhgwgqrf
tyedqdgrisdlevplvgdyqqrnmaiaiqtakvyakqtewpltpqnirqglaash

Timeline for d2gcaa2:

• d2gcaa2 first appeared in SCOP 1.73
  
• d2gcaa2 appears in SCOPe 2.01
  
• d2gcaa2 appears in the current release, SCOPe 2.08