SCOPe 2.05: Domain d2gc9a1: 2gc9 A:1-178

Lineage for d2gc9a1 (2gc9 A:1-178)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.6: Phenolic acid decarboxylase (PAD) [141469] (2 proteins)
   Pfam PF05870; dimeric enzyme made of lipocalin-like subunits

6. Protein P-coumaric acid decarboxylase, pdc [141470] (1 species)

7. Species Lactobacillus plantarum [TaxId:1590] [141471] (2 PDB entries)
   Uniprot Q88RY7 1-178

8. Domain d2gc9a1: 2gc9 A:1-178 [134972]
   complexed with cit, edo, so4

Details for d2gc9a1

PDB Entry: 2gc9, 1.7 Å

PDB Description: Crystal structure of p-coumaric acid decarboxylase (NP_786857.1) from Lactobacillus plantarum at 1.70 A resolution

PDB Compounds: (A:) p-coumaric acid decarboxylase

SCOPe Domain Sequences for d2gc9a1:

Sequence; same for both SEQRES and ATOM records:

>d2gc9a1 b.60.1.6 (A:1-178) P-coumaric acid decarboxylase, pdc {Lactobacillus plantarum [TaxId: 1590]}
mtktfktlddflgthfiytydngweyewyakndhtvdyrihggmvagrwvtdqkadivml
tegiykiswteptgtdvaldfmpnekklhgtiffpkwveehpeitvtyqnehidlmeqsr
ekyatypklvvpefanitymgdagqnnedviseapykempndirngkyfdqnyhrlnk

Timeline for d2gc9a1:

• d2gc9a1 first appeared in SCOP 1.73
  
• d2gc9a1 appears in SCOPe 2.04
  
• d2gc9a1 appears in SCOPe 2.06
  
• d2gc9a1 appears in the current release, SCOPe 2.08