Lineage for d2gc8b1 (2gc8 B:1-562)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 743030Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 743031Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 743413Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (2 proteins)
  6. 743421Protein Viral RNA polymerase [56695] (9 species)
  7. 743434Species Hepatitis C virus [TaxId:11103] [56697] (21 PDB entries)
  8. 743458Domain d2gc8b1: 2gc8 B:1-562 [134971]
    automatically matched to d1nhvb_
    complexed with 885

Details for d2gc8b1

PDB Entry: 2gc8 (more details), 2.2 Å

PDB Description: Structure of a Proline Sulfonamide Inhibitor Bound to HCV NS5b Polymerase
PDB Compounds: (B:) RNA-directed RNA polymerase

SCOP Domain Sequences for d2gc8b1:

Sequence, based on SEQRES records: (download)

>d2gc8b1 e.8.1.4 (B:1-562) Viral RNA polymerase {Hepatitis C virus [TaxId: 11103]}
smsytwtgalitpcaaeesklpinalsnsllrhhnmvyattsrsaglrqkkvtfdrlqvl
ddhyrdvlkemkakastvkakllsveeackltpphsakskfgygakdvrnlsskavnhih
svwkdlledtvtpidttimaknevfcvqpekggrkparlivfpdlgvrvcekmalydvvs
tlpqvvmgssygfqyspgqrveflvntwkskknpmgfsydtrcfdstvtendirveesiy
qccdlapearqaikslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkas
aacraaklqdctmlvngddlvvicesagtqedaaslrvfteamtrysappgdppqpeydl
elitscssnvsvahdasgkrvyyltrdpttplaraawetarhtpvnswlgniimyaptlw
armilmthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsafslhsyspg
einrvasclrklgvpplrvwrhrarsvrarllsqggraatcgkylfnwavktklkltpip
aasqldlsgwfvagysggdiyh

Sequence, based on observed residues (ATOM records): (download)

>d2gc8b1 e.8.1.4 (B:1-562) Viral RNA polymerase {Hepatitis C virus [TaxId: 11103]}
smsytwtgalitpcaaeesklpinalsnsllrhhnmvyattsrsaglrqkkvtfdrlqvl
ddhyrdvlkemkakastvkakllsveeackltpphsakskfgygakdvrnlsskavnhih
svwkdlledtvtpidttimaknevfcvqrkparlivfpdlgvrvcekmalydvvstlpqv
vmgssygfqyspgqrveflvntwkskknpmgfsydtrcfdstvtendirveesiyqccdl
apearqaikslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkasaacra
aklqdctmlvngddlvvicesagtqedaaslrvfteamtrysappgdppqpeydlelits
cssnvsvahdasgkrvyyltrdpttplaraawetarhtpvnswlgniimyaptlwarmil
mthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsafslhsyspgeinrv
asclrklgvpplrvwrhrarsvrarllsqggraatcgkylfnwavktklkltpipqldls
gwfvagysggdiyh

SCOP Domain Coordinates for d2gc8b1:

Click to download the PDB-style file with coordinates for d2gc8b1.
(The format of our PDB-style files is described here.)

Timeline for d2gc8b1: