Class g: Small proteins [56992] (100 folds) |
Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily) disulfide-rich; nearly all-beta |
Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) |
Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins) automatically mapped to Pfam PF02975 |
Protein automated matches [190303] (3 species) not a true protein |
Species Paracoccus denitrificans [TaxId:266] [187112] (6 PDB entries) |
Domain d2gc7n_: 2gc7 N: [134967] Other proteins in same PDB: d2gc7a_, d2gc7c_, d2gc7d_, d2gc7e_, d2gc7g_, d2gc7h_, d2gc7i_, d2gc7k_, d2gc7l_, d2gc7m_, d2gc7o_, d2gc7p_ automated match to d1mg2b_ complexed with hec, na |
PDB Entry: 2gc7 (more details), 1.9 Å
SCOPe Domain Sequences for d2gc7n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gc7n_ g.21.1.1 (N:) automated matches {Paracoccus denitrificans [TaxId: 266]} tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi vgkas
Timeline for d2gc7n_: