![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) ![]() |
![]() | Family b.69.2.0: automated matches [232760] (1 protein) not a true family |
![]() | Protein automated matches [232762] (1 species) not a true protein |
![]() | Species Paracoccus denitrificans [TaxId:318586] [232763] (18 PDB entries) |
![]() | Domain d2gc7m_: 2gc7 M: [134966] Other proteins in same PDB: d2gc7b_, d2gc7c_, d2gc7d_, d2gc7f_, d2gc7g_, d2gc7h_, d2gc7j_, d2gc7k_, d2gc7l_, d2gc7n_, d2gc7o_, d2gc7p_ automated match to d3l4od_ complexed with hem, na |
PDB Entry: 2gc7 (more details), 1.9 Å
SCOPe Domain Sequences for d2gc7m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gc7m_ b.69.2.0 (M:) automated matches {Paracoccus denitrificans [TaxId: 318586]} eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvi dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg eelrsvnqlghgpqvittadmg
Timeline for d2gc7m_: