Lineage for d2gc7m_ (2gc7 M:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1803012Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1803039Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) (S)
  5. 1803075Family b.69.2.0: automated matches [232760] (1 protein)
    not a true family
  6. 1803076Protein automated matches [232762] (1 species)
    not a true protein
  7. 1803077Species Paracoccus denitrificans [TaxId:318586] [232763] (18 PDB entries)
  8. 1803097Domain d2gc7m_: 2gc7 M: [134966]
    Other proteins in same PDB: d2gc7b_, d2gc7c_, d2gc7d_, d2gc7f_, d2gc7g_, d2gc7h_, d2gc7j_, d2gc7k_, d2gc7l_, d2gc7n_, d2gc7o_, d2gc7p_
    automated match to d3l4od_
    complexed with hem, na

Details for d2gc7m_

PDB Entry: 2gc7 (more details), 1.9 Å

PDB Description: substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.
PDB Compounds: (M:) Methylamine dehydrogenase heavy chain

SCOPe Domain Sequences for d2gc7m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gc7m_ b.69.2.0 (M:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvi
dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad
ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi
fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt
ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew
rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg
eelrsvnqlghgpqvittadmg

SCOPe Domain Coordinates for d2gc7m_:

Click to download the PDB-style file with coordinates for d2gc7m_.
(The format of our PDB-style files is described here.)

Timeline for d2gc7m_: