![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein Amicyanin [49505] (2 species) |
![]() | Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries) Uniprot P22364 |
![]() | Domain d2gc7g_: 2gc7 G: [134960] Other proteins in same PDB: d2gc7a_, d2gc7b_, d2gc7d_, d2gc7e_, d2gc7f_, d2gc7h_, d2gc7i_, d2gc7j_, d2gc7l_, d2gc7m_, d2gc7n_, d2gc7p_ automated match to d1aac__ complexed with hem, na |
PDB Entry: 2gc7 (more details), 1.9 Å
SCOPe Domain Sequences for d2gc7g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gc7g_ b.6.1.1 (G:) Amicyanin {Paracoccus denitrificans [TaxId: 266]} dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
Timeline for d2gc7g_: