Lineage for d2gc7g1 (2gc7 G:1-105)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 660500Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
    mono-domain proteins
  6. 660501Protein Amicyanin [49505] (2 species)
  7. 660502Species Paracoccus denitrificans [TaxId:266] [49506] (19 PDB entries)
  8. 660518Domain d2gc7g1: 2gc7 G:1-105 [134960]
    Other proteins in same PDB: d2gc7a1, d2gc7b1, d2gc7d1, d2gc7e1, d2gc7f1, d2gc7h1, d2gc7i1, d2gc7j1, d2gc7l1, d2gc7m1, d2gc7n1, d2gc7p1
    automatically matched to d1aac__
    complexed with hem, na, trq

Details for d2gc7g1

PDB Entry: 2gc7 (more details), 1.9 Å

PDB Description: substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.
PDB Compounds: (G:) amicyanin

SCOP Domain Sequences for d2gc7g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gc7g1 b.6.1.1 (G:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

SCOP Domain Coordinates for d2gc7g1:

Click to download the PDB-style file with coordinates for d2gc7g1.
(The format of our PDB-style files is described here.)

Timeline for d2gc7g1: