Lineage for d2gc7d_ (2gc7 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980707Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1980773Protein Cytochrome c551 [46660] (5 species)
  7. 1980776Species Paracoccus denitrificans [TaxId:266] [46663] (5 PDB entries)
  8. 1980777Domain d2gc7d_: 2gc7 D: [134957]
    Other proteins in same PDB: d2gc7a_, d2gc7b_, d2gc7c_, d2gc7e_, d2gc7f_, d2gc7g_, d2gc7i_, d2gc7j_, d2gc7k_, d2gc7m_, d2gc7n_, d2gc7o_
    automated match to d1mg2d_
    complexed with hem, na

Details for d2gc7d_

PDB Entry: 2gc7 (more details), 1.9 Å

PDB Description: substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.
PDB Compounds: (D:) cytochrome c-l

SCOPe Domain Sequences for d2gc7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gc7d_ a.3.1.1 (D:) Cytochrome c551 {Paracoccus denitrificans [TaxId: 266]}
apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
rhlytgdpkdaswltdeqkagftpfqp

SCOPe Domain Coordinates for d2gc7d_:

Click to download the PDB-style file with coordinates for d2gc7d_.
(The format of our PDB-style files is described here.)

Timeline for d2gc7d_: