Lineage for d2gc7d1 (2gc7 D:1-147)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633823Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 633824Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 633825Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 633884Protein Cytochrome c551 [46660] (4 species)
  7. 633887Species Paracoccus denitrificans [TaxId:266] [46663] (5 PDB entries)
  8. 633888Domain d2gc7d1: 2gc7 D:1-147 [134957]
    Other proteins in same PDB: d2gc7a1, d2gc7b1, d2gc7c1, d2gc7e1, d2gc7f1, d2gc7g1, d2gc7i1, d2gc7j1, d2gc7k1, d2gc7m1, d2gc7n1, d2gc7o1
    automatically matched to d1mg2d_
    complexed with hem, na, trq

Details for d2gc7d1

PDB Entry: 2gc7 (more details), 1.9 Å

PDB Description: substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.
PDB Compounds: (D:) cytochrome c-l

SCOP Domain Sequences for d2gc7d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gc7d1 a.3.1.1 (D:1-147) Cytochrome c551 {Paracoccus denitrificans [TaxId: 266]}
apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
rhlytgdpkdaswltdeqkagftpfqp

SCOP Domain Coordinates for d2gc7d1:

Click to download the PDB-style file with coordinates for d2gc7d1.
(The format of our PDB-style files is described here.)

Timeline for d2gc7d1: