![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (7 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins) mono-domain proteins |
![]() | Protein Amicyanin [49505] (2 species) |
![]() | Species Paracoccus denitrificans [TaxId:266] [49506] (19 PDB entries) |
![]() | Domain d2gc7c1: 2gc7 C:1-105 [134956] Other proteins in same PDB: d2gc7a1, d2gc7b1, d2gc7d1, d2gc7e1, d2gc7f1, d2gc7h1, d2gc7i1, d2gc7j1, d2gc7l1, d2gc7m1, d2gc7n1, d2gc7p1 automatically matched to d1aac__ complexed with hem, na, trq |
PDB Entry: 2gc7 (more details), 1.9 Å
SCOP Domain Sequences for d2gc7c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gc7c1 b.6.1.1 (C:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
Timeline for d2gc7c1: