Lineage for d2gc7c_ (2gc7 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770401Protein Amicyanin [49505] (2 species)
  7. 2770402Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries)
    Uniprot P22364
  8. 2770437Domain d2gc7c_: 2gc7 C: [134956]
    Other proteins in same PDB: d2gc7a_, d2gc7b_, d2gc7d_, d2gc7e_, d2gc7f_, d2gc7h_, d2gc7i_, d2gc7j_, d2gc7l_, d2gc7m_, d2gc7n_, d2gc7p_
    automated match to d1aac__
    complexed with hec, na

Details for d2gc7c_

PDB Entry: 2gc7 (more details), 1.9 Å

PDB Description: substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.
PDB Compounds: (C:) amicyanin

SCOPe Domain Sequences for d2gc7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gc7c_ b.6.1.1 (C:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

SCOPe Domain Coordinates for d2gc7c_:

Click to download the PDB-style file with coordinates for d2gc7c_.
(The format of our PDB-style files is described here.)

Timeline for d2gc7c_: