SCOP 1.73: Domain d2gc7a1: 2gc7 A:32-386

Lineage for d2gc7a1 (2gc7 A:32-386)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (3 families)

5. Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein)
   less regular propeller without notable sequence repeats; quinone cofactor is a tryptophan derivative in another subunit
   this is a repeat family; one repeat unit is 1mg2 A:132-178 found in domain

6. Protein Methylamine dehydrogenase, H-chain [50971] (2 species)

7. Species Paracoccus denitrificans [TaxId:266] [50972] (10 PDB entries)

8. Domain d2gc7a1: 2gc7 A:32-386 [134954]
   Other proteins in same PDB: d2gc7b1, d2gc7c1, d2gc7d1, d2gc7f1, d2gc7g1, d2gc7h1, d2gc7j1, d2gc7k1, d2gc7l1, d2gc7n1, d2gc7o1, d2gc7p1
   automatically matched to d2bbkh_
   complexed with hem, na, trq

Details for d2gc7a1

PDB Entry: 2gc7, 1.9 Å

PDB Description: substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.

PDB Compounds: (A:) Methylamine dehydrogenase heavy chain

SCOP Domain Sequences for d2gc7a1:

Sequence; same for both SEQRES and ATOM records:

>d2gc7a1 b.69.2.1 (A:32-386) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}
deprileapapdarrvyvndpahfaavtqqfvidgeagrvigmidggflpnpvvaddgsf
iahastvfsriargertdyvevfdpvtllptadielpdaprflvgtypwmtsltpdgktl
lfyqfspapavgvvdlegkafkrmldvpdcyhifptapdtffmhcrdgslakvafgtegt
peithtevfhpedeflinhpaysqkagrlvwptytgkihqidlssgdakflpavealtea
eradgwrpggwqqvayhraldriyllvdqrdewrhktasrfvvvldaktgerlakfemgh
eidsinvsqdekpllyalstgdktlyihdaesgeelrsvnqlghgpqvittadmg

Timeline for d2gc7a1:

• d2gc7a1 is new in SCOP 1.73
  
• d2gc7a1 appears in SCOP 1.75
  
• d2gc7a1 appears in the current release, SCOPe 2.08, called d2gc7a_