![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (3 families) ![]() |
![]() | Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein) less regular propeller without notable sequence repeats; quinone cofactor is a tryptophan derivative in another subunit this is a repeat family; one repeat unit is 1mg2 A:132-178 found in domain |
![]() | Protein Methylamine dehydrogenase, H-chain [50971] (2 species) |
![]() | Species Paracoccus denitrificans [TaxId:266] [50972] (10 PDB entries) |
![]() | Domain d2gc7a1: 2gc7 A:32-386 [134954] Other proteins in same PDB: d2gc7b1, d2gc7c1, d2gc7d1, d2gc7f1, d2gc7g1, d2gc7h1, d2gc7j1, d2gc7k1, d2gc7l1, d2gc7n1, d2gc7o1, d2gc7p1 automatically matched to d2bbkh_ complexed with hem, na, trq |
PDB Entry: 2gc7 (more details), 1.9 Å
SCOP Domain Sequences for d2gc7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gc7a1 b.69.2.1 (A:32-386) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} deprileapapdarrvyvndpahfaavtqqfvidgeagrvigmidggflpnpvvaddgsf iahastvfsriargertdyvevfdpvtllptadielpdaprflvgtypwmtsltpdgktl lfyqfspapavgvvdlegkafkrmldvpdcyhifptapdtffmhcrdgslakvafgtegt peithtevfhpedeflinhpaysqkagrlvwptytgkihqidlssgdakflpavealtea eradgwrpggwqqvayhraldriyllvdqrdewrhktasrfvvvldaktgerlakfemgh eidsinvsqdekpllyalstgdktlyihdaesgeelrsvnqlghgpqvittadmg
Timeline for d2gc7a1: