![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest |
![]() | Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) ![]() |
![]() | Family c.59.1.2: Folylpolyglutamate synthetase, C-terminal domain [53250] (1 protein) |
![]() | Protein Folylpolyglutamate synthetase, C-terminal domain [53251] (2 species) |
![]() | Species Lactobacillus casei [TaxId:1582] [53252] (7 PDB entries) |
![]() | Domain d2gc6a1: 2gc6 A:297-425 [134952] Other proteins in same PDB: d2gc6a2 automatically matched to d1fgs_1 complexed with so4; mutant |
PDB Entry: 2gc6 (more details), 1.9 Å
SCOPe Domain Sequences for d2gc6a1:
Sequence, based on SEQRES records: (download)
>d2gc6a1 c.59.1.2 (A:297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei [TaxId: 1582]} wparlekisdtplividgahnpdginglitalkqlfsqpitviagiladkdyaamadrlt aafstvylvpvpgtpralpeagyealhegrlkdswqealaaslndvpdqpivitgslyla savrqtllg
>d2gc6a1 c.59.1.2 (A:297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei [TaxId: 1582]} wparlekisdtplividgahnpdginglitalkqlfsqpitviagilyaamadrltaafs tvylvpvpgtpralrlkdswqealaaslndvpdqpivitgslylasavrqtllg
Timeline for d2gc6a1: