Class b: All beta proteins [48724] (177 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein Amicyanin [49505] (2 species) |
Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries) Uniprot P22364 |
Domain d2gc4o_: 2gc4 O: [134948] Other proteins in same PDB: d2gc4a_, d2gc4b_, d2gc4d_, d2gc4e_, d2gc4f_, d2gc4h_, d2gc4i_, d2gc4j_, d2gc4l_, d2gc4m_, d2gc4n_, d2gc4p_ automated match to d1aac__ complexed with cu, hem, na |
PDB Entry: 2gc4 (more details), 1.9 Å
SCOPe Domain Sequences for d2gc4o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gc4o_ b.6.1.1 (O:) Amicyanin {Paracoccus denitrificans [TaxId: 266]} dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
Timeline for d2gc4o_: