Lineage for d2gc4n_ (2gc4 N:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034451Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 3034452Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 3034453Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 3034510Protein automated matches [190303] (3 species)
    not a true protein
  7. 3034511Species Paracoccus denitrificans [TaxId:266] [187112] (6 PDB entries)
  8. 3034517Domain d2gc4n_: 2gc4 N: [134947]
    Other proteins in same PDB: d2gc4a_, d2gc4c_, d2gc4d_, d2gc4e_, d2gc4g_, d2gc4h_, d2gc4i_, d2gc4k_, d2gc4l_, d2gc4m_, d2gc4o_, d2gc4p_
    automated match to d1mg2b_
    complexed with cu, hec, na

Details for d2gc4n_

PDB Entry: 2gc4 (more details), 1.9 Å

PDB Description: structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
PDB Compounds: (N:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d2gc4n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gc4n_ g.21.1.1 (N:) automated matches {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d2gc4n_:

Click to download the PDB-style file with coordinates for d2gc4n_.
(The format of our PDB-style files is described here.)

Timeline for d2gc4n_: