Lineage for d2gc4a_ (2gc4 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808749Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) (S)
  5. 2808785Family b.69.2.0: automated matches [232760] (1 protein)
    not a true family
  6. 2808786Protein automated matches [232762] (1 species)
    not a true protein
  7. 2808787Species Paracoccus denitrificans [TaxId:318586] [232763] (18 PDB entries)
  8. 2808808Domain d2gc4a_: 2gc4 A: [134934]
    Other proteins in same PDB: d2gc4b_, d2gc4c_, d2gc4d_, d2gc4f_, d2gc4g_, d2gc4h_, d2gc4j_, d2gc4k_, d2gc4l_, d2gc4n_, d2gc4o_, d2gc4p_
    automated match to d3l4od_
    complexed with cu, hec, na

Details for d2gc4a_

PDB Entry: 2gc4 (more details), 1.9 Å

PDB Description: structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
PDB Compounds: (A:) Methylamine dehydrogenase heavy chain

SCOPe Domain Sequences for d2gc4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gc4a_ b.69.2.0 (A:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvi
dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad
ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi
fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt
ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew
rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg
eelrsvnqlghgpqvittadmg

SCOPe Domain Coordinates for d2gc4a_:

Click to download the PDB-style file with coordinates for d2gc4a_.
(The format of our PDB-style files is described here.)

Timeline for d2gc4a_: