SCOPe 2.05: Domain d2gc3b_: 2gc3 B:

Lineage for d2gc3b_ (2gc3 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (2 proteins)
   automatically mapped to Pfam PF06560

6. Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species)
   Type II phosphoglucose isomerase

7. Species Pyrococcus furiosus [TaxId:2261] [89405] (10 PDB entries)
   Uniprot P83194

8. Domain d2gc3b_: 2gc3 B: [134933]
   automated match to d1x7na_
   complexed with m6p, zn

Details for d2gc3b_

PDB Entry: 2gc3, 2.1 Å

PDB Description: the crystal structure of phosphoglucose isomerase from pyrococcus furiosus in complex with mannose 6-phosphate and zinc

PDB Compounds: (B:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d2gc3b_:

Sequence; same for both SEQRES and ATOM records:

>d2gc3b_ b.82.1.7 (B:) Glucose-6-phosphate isomerase, GPI {Pyrococcus furiosus [TaxId: 2261]}
mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw
ismepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev
kvvdnprw

Timeline for d2gc3b_:

• d2gc3b_ first appeared in SCOP 1.73, called d2gc3b1
  
• d2gc3b_ appears in SCOPe 2.04
  
• d2gc3b_ is called d2gc3b2 in SCOPe 2.06
  
• d2gc3b_ appears in the current release, SCOPe 2.08, called d2gc3b2