Lineage for d2gc3b_ (2gc3 B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1558339Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1558340Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1558598Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (2 proteins)
    automatically mapped to Pfam PF06560
  6. 1558599Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species)
    Type II phosphoglucose isomerase
  7. 1558600Species Pyrococcus furiosus [TaxId:2261] [89405] (10 PDB entries)
    Uniprot P83194
  8. 1558614Domain d2gc3b_: 2gc3 B: [134933]
    automated match to d1x7na_
    complexed with m6p, zn

Details for d2gc3b_

PDB Entry: 2gc3 (more details), 2.1 Å

PDB Description: the crystal structure of phosphoglucose isomerase from pyrococcus furiosus in complex with mannose 6-phosphate and zinc
PDB Compounds: (B:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d2gc3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gc3b_ b.82.1.7 (B:) Glucose-6-phosphate isomerase, GPI {Pyrococcus furiosus [TaxId: 2261]}
mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw
ismepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev
kvvdnprw

SCOPe Domain Coordinates for d2gc3b_:

Click to download the PDB-style file with coordinates for d2gc3b_.
(The format of our PDB-style files is described here.)

Timeline for d2gc3b_: