Lineage for d2gc3a1 (2gc3 A:0-186)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677267Superfamily b.82.1: RmlC-like cupins [51182] (20 families) (S)
  5. 677479Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (1 protein)
  6. 677480Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species)
    Type II phosphoglucose isomerase
  7. 677492Species Archaeon Thermococcus litoralis [TaxId:2265] [101975] (7 PDB entries)
  8. 677497Domain d2gc3a1: 2gc3 A:0-186 [134932]
    automatically matched to d1j3pa_
    complexed with m6p, zn

Details for d2gc3a1

PDB Entry: 2gc3 (more details), 2.1 Å

PDB Description: the crystal structure of phosphoglucose isomerase from pyrococcus furiosus in complex with mannose 6-phosphate and zinc
PDB Compounds: (A:) Glucose-6-phosphate isomerase

SCOP Domain Sequences for d2gc3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gc3a1 b.82.1.7 (A:0-186) Glucose-6-phosphate isomerase, GPI {Archaeon Thermococcus litoralis [TaxId: 2265]}
mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw
ismepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev
kvvdnpr

SCOP Domain Coordinates for d2gc3a1:

Click to download the PDB-style file with coordinates for d2gc3a1.
(The format of our PDB-style files is described here.)

Timeline for d2gc3a1: