![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (20 families) ![]() |
![]() | Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (1 protein) |
![]() | Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species) Type II phosphoglucose isomerase |
![]() | Species Archaeon Thermococcus litoralis [TaxId:2265] [101975] (7 PDB entries) |
![]() | Domain d2gc3a1: 2gc3 A:0-186 [134932] automatically matched to d1j3pa_ complexed with m6p, zn |
PDB Entry: 2gc3 (more details), 2.1 Å
SCOP Domain Sequences for d2gc3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gc3a1 b.82.1.7 (A:0-186) Glucose-6-phosphate isomerase, GPI {Archaeon Thermococcus litoralis [TaxId: 2265]} mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw ismepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev kvvdnpr
Timeline for d2gc3a1: