SCOPe 2.08: Domain d2gc3a2: 2gc3 A:1-187

Lineage for d2gc3a2 (2gc3 A:1-187)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (2 proteins)
   automatically mapped to Pfam PF06560

6. Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species)
   Type II phosphoglucose isomerase

7. Species Pyrococcus furiosus [TaxId:2261] [89405] (10 PDB entries)
   Uniprot P83194

8. Domain d2gc3a2: 2gc3 A:1-187 [134932]
   Other proteins in same PDB: d2gc3a3, d2gc3b3
   automated match to d1x7na_
   complexed with m6p, zn

Details for d2gc3a2

PDB Entry: 2gc3, 2.1 Å

PDB Description: the crystal structure of phosphoglucose isomerase from pyrococcus furiosus in complex with mannose 6-phosphate and zinc

PDB Compounds: (A:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d2gc3a2:

Sequence; same for both SEQRES and ATOM records:

>d2gc3a2 b.82.1.7 (A:1-187) Glucose-6-phosphate isomerase, GPI {Pyrococcus furiosus [TaxId: 2261]}
mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
vvdnprw

Timeline for d2gc3a2:

• d2gc3a2 first appeared in SCOP 1.73, called d2gc3a1
  
• d2gc3a2 appears in SCOPe 2.07