![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (2 proteins) automatically mapped to Pfam PF06560 |
![]() | Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species) Type II phosphoglucose isomerase |
![]() | Species Pyrococcus furiosus [TaxId:2261] [89405] (10 PDB entries) Uniprot P83194 |
![]() | Domain d2gc2a_: 2gc2 A: [134930] automated match to d1x7na_ complexed with f6r, zn |
PDB Entry: 2gc2 (more details), 2.1 Å
SCOPe Domain Sequences for d2gc2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gc2a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Pyrococcus furiosus [TaxId: 2261]} mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw ismepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev kvvdnprw
Timeline for d2gc2a_: