Lineage for d2gc2a_ (2gc2 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1807021Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1807282Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (2 proteins)
    automatically mapped to Pfam PF06560
  6. 1807283Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species)
    Type II phosphoglucose isomerase
  7. 1807284Species Pyrococcus furiosus [TaxId:2261] [89405] (10 PDB entries)
    Uniprot P83194
  8. 1807299Domain d2gc2a_: 2gc2 A: [134930]
    automated match to d1x7na_
    complexed with f6r, zn

Details for d2gc2a_

PDB Entry: 2gc2 (more details), 2.1 Å

PDB Description: The crystal structure of phosphoglucose isomerase from Pyrococcus furiosus in complex with Fructose 6-phosphate and zinc
PDB Compounds: (A:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d2gc2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gc2a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Pyrococcus furiosus [TaxId: 2261]}
mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw
ismepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev
kvvdnprw

SCOPe Domain Coordinates for d2gc2a_:

Click to download the PDB-style file with coordinates for d2gc2a_.
(The format of our PDB-style files is described here.)

Timeline for d2gc2a_: