Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (24 families) |
Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (1 protein) |
Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species) Type II phosphoglucose isomerase |
Species Archaeon Thermococcus litoralis [TaxId:2265] [101975] (7 PDB entries) |
Domain d2gc0a1: 2gc0 A:0-186 [134926] automatically matched to d1j3pa_ complexed with pan, zn |
PDB Entry: 2gc0 (more details), 2 Å
SCOP Domain Sequences for d2gc0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gc0a1 b.82.1.7 (A:0-186) Glucose-6-phosphate isomerase, GPI {Archaeon Thermococcus litoralis [TaxId: 2265]} mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw ismepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev kvvdnpr
Timeline for d2gc0a1: