SCOP 1.75: Domain d2gc0a1: 2gc0 A:0-186

Lineage for d2gc0a1 (2gc0 A:0-186)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (24 families)

5. Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (1 protein)

6. Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species)
   Type II phosphoglucose isomerase

7. Species Archaeon Thermococcus litoralis [TaxId:2265] [101975] (7 PDB entries)

8. Domain d2gc0a1: 2gc0 A:0-186 [134926]
   automatically matched to d1j3pa_
   complexed with pan, zn

Details for d2gc0a1

PDB Entry: 2gc0, 2 Å

PDB Description: The crystal structure of phosphoglucose isomerase from Pyrococcus furiosus in complex with 5-phospho-D-arabinonohydroxamate and zinc

PDB Compounds: (A:) Glucose-6-phosphate isomerase

SCOP Domain Sequences for d2gc0a1:

Sequence; same for both SEQRES and ATOM records:

>d2gc0a1 b.82.1.7 (A:0-186) Glucose-6-phosphate isomerase, GPI {Archaeon Thermococcus litoralis [TaxId: 2265]}
mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw
ismepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev
kvvdnpr

Timeline for d2gc0a1:

• d2gc0a1 first appeared in SCOP 1.73
  
• d2gc0a1 is called d2gc0a_ in SCOPe 2.01
  
• d2gc0a1 appears in the current release, SCOPe 2.08, called d2gc0a2