SCOPe 2.07: Domain d2gbsa1: 2gbs A:2-137

Lineage for d2gbsa1 (2gbs A:2-137)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.8: Atu2648/PH1033-like [141703] (7 proteins)
   Pfam PF01878; DUF55

6. Protein Hypothetical protein RPA0253 [141710] (1 species)

7. Species Rhodopseudomonas palustris [TaxId:1076] [141711] (1 PDB entry)
   Uniprot Q6ND56 2-137

8. Domain d2gbsa1: 2gbs A:2-137 [134925]
   Other proteins in same PDB: d2gbsa2

Details for d2gbsa1

PDB Entry: 2gbs

PDB Description: nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3

PDB Compounds: (A:) Hypothetical protein Rpa0253

SCOPe Domain Sequences for d2gbsa1:

Sequence; same for both SEQRES and ATOM records:

>d2gbsa1 b.122.1.8 (A:2-137) Hypothetical protein RPA0253 {Rhodopseudomonas palustris [TaxId: 1076]}
aywlvksepsvwswdqqvakgaageawtgvrnhsaklhmvamrrgdrafyyhsnegkeiv
giaeiireaypdptdasgkfvcvdikadkplktpvtlaavkaeprladmalmkysrlsvq
pvtaeewklvckmggl

Timeline for d2gbsa1:

• d2gbsa1 first appeared in SCOP 1.73
  
• d2gbsa1 appears in SCOPe 2.06
  
• d2gbsa1 appears in the current release, SCOPe 2.08