Lineage for d2gbsa1 (2gbs A:2-137)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680324Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 680325Superfamily b.122.1: PUA domain-like [88697] (10 families) (S)
  5. 680447Family b.122.1.8: Atu2648/PH1033-like [141703] (6 proteins)
    Pfam PF01878; DUF55
  6. 680465Protein Hypothetical protein RPA0253 [141710] (1 species)
  7. 680466Species Rhodopseudomonas palustris [TaxId:1076] [141711] (1 PDB entry)
  8. 680467Domain d2gbsa1: 2gbs A:2-137 [134925]
    mutant

Details for d2gbsa1

PDB Entry: 2gbs (more details)

PDB Description: nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3
PDB Compounds: (A:) Hypothetical protein Rpa0253

SCOP Domain Sequences for d2gbsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gbsa1 b.122.1.8 (A:2-137) Hypothetical protein RPA0253 {Rhodopseudomonas palustris [TaxId: 1076]}
aywlvksepsvwswdqqvakgaageawtgvrnhsaklhmvamrrgdrafyyhsnegkeiv
giaeiireaypdptdasgkfvcvdikadkplktpvtlaavkaeprladmalmkysrlsvq
pvtaeewklvckmggl

SCOP Domain Coordinates for d2gbsa1:

Click to download the PDB-style file with coordinates for d2gbsa1.
(The format of our PDB-style files is described here.)

Timeline for d2gbsa1: