Class b: All beta proteins [48724] (180 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (15 families) |
Family b.122.1.8: Atu2648/PH1033-like [141703] (7 proteins) Pfam PF01878; DUF55 |
Protein Hypothetical protein RPA0253 [141710] (1 species) |
Species Rhodopseudomonas palustris [TaxId:1076] [141711] (1 PDB entry) Uniprot Q6ND56 2-137 |
Domain d2gbsa1: 2gbs A:2-137 [134925] Other proteins in same PDB: d2gbsa2 |
PDB Entry: 2gbs (more details)
SCOPe Domain Sequences for d2gbsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gbsa1 b.122.1.8 (A:2-137) Hypothetical protein RPA0253 {Rhodopseudomonas palustris [TaxId: 1076]} aywlvksepsvwswdqqvakgaageawtgvrnhsaklhmvamrrgdrafyyhsnegkeiv giaeiireaypdptdasgkfvcvdikadkplktpvtlaavkaeprladmalmkysrlsvq pvtaeewklvckmggl
Timeline for d2gbsa1: