SCOPe 2.05: Domain d2gbob_: 2gbo B:

Lineage for d2gbob_ (2gbo B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.6: EF2458-like [140404] (2 families)
   N-terminal helix swapped dimer; interrupted antiparallel coiled coil

5. Family a.23.6.1: EF2458-like [140405] (1 protein)
   Pfam PF07408; DUF1507

6. Protein Hypothetical protein EF2458 [140406] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [140407] (1 PDB entry)
   Uniprot Q831P3 1-82

8. Domain d2gbob_: 2gbo B: [134924]
   automated match to d2gboa1

Details for d2gbob_

PDB Entry: 2gbo, 2.2 Å

PDB Description: Protein of Unknown Function EF2458 from Enterococcus faecalis

PDB Compounds: (B:) UPF0358 protein EF2458

SCOPe Domain Sequences for d2gbob_:

Sequence; same for both SEQRES and ATOM records:

>d2gbob_ a.23.6.1 (B:) Hypothetical protein EF2458 {Enterococcus faecalis [TaxId: 1351]}
mdegiskkfaiqlleddaerikmlirnqknslcisqckafeevvdtqmygfsrqvtyatr
lgiltndeghrllsdlerelnq

Timeline for d2gbob_:

• d2gbob_ first appeared in SCOP 1.73, called d2gbob1
  
• d2gbob_ appears in SCOPe 2.04
  
• d2gbob_ appears in SCOPe 2.06
  
• d2gbob_ appears in the current release, SCOPe 2.08