![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.67: PLP-dependent transferases [53382] (1 superfamily) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) ![]() |
![]() | Family c.67.1.1: AAT-like [53384] (16 proteins) |
![]() | Protein AAT homologue TM1698 [142661] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [142662] (1 PDB entry) |
![]() | Domain d2gb3d1: 2gb3 D:4-390 [134906] automatically matched to 2GB3 A:4-392 |
PDB Entry: 2gb3 (more details), 2.5 Å
SCOP Domain Sequences for d2gb3d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gb3d1 c.67.1.1 (D:4-390) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} fsdrvllteespirklvpfaemakkrgvrihhlnigqpdlktpevfferiyenkpevvyy shsagiwelreafasyykrrqrvdvkpenvlvtnggseailfsfavianpgdeilvlepf yanynafakiagvklipvtrrmeegfaipqnlesfinertkgivlsnpcnptgvvygkde mrylveiaerhglflivdevyseivfrgefasalsiesdkvvvidsvskkfsacgarvgc litrneelishamklaqgrlapplleqigsvgllnlddsffdfvretyrervetvlkkle ehglkrftkpsgafyitaelpvedaeefarwmltdfnmdgettmvaplrgfyltpglgkk eiriacvlekdllsraidvlmeglkmf
Timeline for d2gb3d1: