Lineage for d2gb3a1 (2gb3 A:4-392)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 840449Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 840450Superfamily c.67.1: PLP-dependent transferases [53383] (9 families) (S)
  5. 840451Family c.67.1.1: AAT-like [53384] (16 proteins)
  6. 840452Protein AAT homologue TM1698 [142661] (1 species)
  7. 840453Species Thermotoga maritima [TaxId:2336] [142662] (1 PDB entry)
    Uniprot Q9X224 4-392
  8. 840454Domain d2gb3a1: 2gb3 A:4-392 [134903]

Details for d2gb3a1

PDB Entry: 2gb3 (more details), 2.5 Å

PDB Description: Crystal structure of Aspartate aminotransferase (tm1698) from Thermotoga maritima at 2.50 A resolution
PDB Compounds: (A:) aspartate aminotransferase

SCOP Domain Sequences for d2gb3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]}
fsdrvllteespirklvpfaemakkrgvrihhlnigqpdlktpevfferiyenkpevvyy
shsagiwelreafasyykrrqrvdvkpenvlvtnggseailfsfavianpgdeilvlepf
yanynafakiagvklipvtrrmeegfaipqnlesfinertkgivlsnpcnptgvvygkde
mrylveiaerhglflivdevyseivfrgefasalsiesdkvvvidsvskkfsacgarvgc
litrneelishamklaqgrlapplleqigsvgllnlddsffdfvretyrervetvlkkle
ehglkrftkpsgafyitaelpvedaeefarwmltdfnmdgettmvaplrgfyltpglgkk
eiriacvlekdllsraidvlmeglkmfcs

SCOP Domain Coordinates for d2gb3a1:

Click to download the PDB-style file with coordinates for d2gb3a1.
(The format of our PDB-style files is described here.)

Timeline for d2gb3a1: