SCOPe 2.05: Domain d2gb0b2: 2gb0 B:218-321

Lineage for d2gb0b2 (2gb0 B:218-321)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins)

6. Protein Sarcosine oxidase [54388] (1 species)

7. Species Bacillus sp., strain b0618 [TaxId:1409] [54389] (16 PDB entries)

8. Domain d2gb0b2: 2gb0 B:218-321 [134902]
   Other proteins in same PDB: d2gb0a1, d2gb0b1
   automated match to d1l9ea2
   complexed with cl, fad, po4

Details for d2gb0b2

PDB Entry: 2gb0, 1.85 Å

PDB Description: monomeric sarcosine oxidase: structure of a covalently flavinylated amine oxidizing enzyme

PDB Compounds: (B:) Monomeric sarcosine oxidase

SCOPe Domain Sequences for d2gb0b2:

Sequence; same for both SEQRES and ATOM records:

>d2gb0b2 d.16.1.3 (B:218-321) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}
lqpyrqvvgffesdeskysndidfpgfmvevpngiyygfpsfggcglklgyhtfgqkidp
dtinrefgvypedesnlrafleeympgangelkrgavcmytktl

Timeline for d2gb0b2:

• d2gb0b2 first appeared in SCOP 1.73
  
• d2gb0b2 appears in SCOPe 2.04
  
• d2gb0b2 appears in SCOPe 2.06
  
• d2gb0b2 appears in the current release, SCOPe 2.08