Lineage for d2gb0a1 (2gb0 A:1-217,A:322-385)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 822279Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 822280Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 822334Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 822614Protein Sarcosine oxidase [51920] (1 species)
  7. 822615Species Bacillus sp., strain b0618 [TaxId:1409] [51921] (13 PDB entries)
  8. 822624Domain d2gb0a1: 2gb0 A:1-217,A:322-385 [134899]
    Other proteins in same PDB: d2gb0a2, d2gb0b2
    automatically matched to d1l9fb1
    complexed with cl, fad, po4

Details for d2gb0a1

PDB Entry: 2gb0 (more details), 1.85 Å

PDB Description: monomeric sarcosine oxidase: structure of a covalently flavinylated amine oxidizing enzyme
PDB Compounds: (A:) Monomeric sarcosine oxidase

SCOP Domain Sequences for d2gb0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gb0a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}
sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
dsvkietangsytadklivsmgawnskllsklnldipXdehfiidlhpehsnvviaagfs
ghgfkfssgvgevlsqlaltgktehdisifsinrpalkeslq

SCOP Domain Coordinates for d2gb0a1:

Click to download the PDB-style file with coordinates for d2gb0a1.
(The format of our PDB-style files is described here.)

Timeline for d2gb0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gb0a2