SCOPe 2.08: Domain d2gaua2: 2gau A:10-151

Lineage for d2gaua2 (2gau A:10-151)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein Transcriptional regulator PG0396, N-terminal domain [141643] (1 species)

7. Species Porphyromonas gingivalis [TaxId:837] [141644] (1 PDB entry)
   Uniprot Q7MAW7 10-151

8. Domain d2gaua2: 2gau A:10-151 [134895]
   Other proteins in same PDB: d2gaua1

Details for d2gaua2

PDB Entry: 2gau, 1.9 Å

PDB Description: Crystal structure of transcriptional regulator, Crp/Fnr family from Porphyromonas gingivalis (APC80792), Structural genomics, MCSG

PDB Compounds: (A:) transcriptional regulator, Crp/Fnr family

SCOPe Domain Sequences for d2gaua2:

Sequence, based on SEQRES records:

>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]}
lghllrdvwsllneeerelldkeiqpfpckkastvfsegdipnnlfylyegkikilregv
ygrfhisrivkpgqffgmrpyfaeetcsstaiavenskvlaipveaieallkgntsfcry
flkalakelgyaerrtvtltqk

Sequence, based on observed residues (ATOM records):

>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]}
lghllrdvwsllneeerelldkeiqpfpckkastvfsegdipnnlfylyegkikilrrfh
isrivkpgqffgmrpyfaeetcsstaiavenskvlaipveaieallkgntsfcryflkal
akelgyaerrtvtltqk

Timeline for d2gaua2:

• d2gaua2 first appeared in SCOP 1.73
  
• d2gaua2 appears in SCOPe 2.07