![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
![]() | Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
![]() | Protein Transcriptional regulator PG0396, N-terminal domain [141643] (1 species) |
![]() | Species Porphyromonas gingivalis [TaxId:837] [141644] (1 PDB entry) Uniprot Q7MAW7 10-151 |
![]() | Domain d2gaua2: 2gau A:10-151 [134895] Other proteins in same PDB: d2gaua1 |
PDB Entry: 2gau (more details), 1.9 Å
SCOPe Domain Sequences for d2gaua2:
Sequence, based on SEQRES records: (download)
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} lghllrdvwsllneeerelldkeiqpfpckkastvfsegdipnnlfylyegkikilregv ygrfhisrivkpgqffgmrpyfaeetcsstaiavenskvlaipveaieallkgntsfcry flkalakelgyaerrtvtltqk
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} lghllrdvwsllneeerelldkeiqpfpckkastvfsegdipnnlfylyegkikilrrfh isrivkpgqffgmrpyfaeetcsstaiavenskvlaipveaieallkgntsfcryflkal akelgyaerrtvtltqk
Timeline for d2gaua2: