Lineage for d2gaua1 (2gau A:152-232)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693005Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)
  6. 2693096Protein Transcriptional regulator PG0396, C-terminal domain [140229] (1 species)
  7. 2693097Species Porphyromonas gingivalis [TaxId:837] [140230] (1 PDB entry)
    Uniprot Q7MAW7 152-232
  8. 2693098Domain d2gaua1: 2gau A:152-232 [134894]
    Other proteins in same PDB: d2gaua2

Details for d2gaua1

PDB Entry: 2gau (more details), 1.9 Å

PDB Description: Crystal structure of transcriptional regulator, Crp/Fnr family from Porphyromonas gingivalis (APC80792), Structural genomics, MCSG
PDB Compounds: (A:) transcriptional regulator, Crp/Fnr family

SCOPe Domain Sequences for d2gaua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]}
hvrgrlaetllilkenfgfendgatlsiylsreelatlsnmtvsnairtlstfvsermla
ldgkrikiidcdrlqktarsg

SCOPe Domain Coordinates for d2gaua1:

Click to download the PDB-style file with coordinates for d2gaua1.
(The format of our PDB-style files is described here.)

Timeline for d2gaua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gaua2