![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family) ![]() |
![]() | Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (2 proteins) |
![]() | Protein FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47214] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47215] (7 PDB entries) |
![]() | Domain d2gaqa1: 2gaq A:4-98 [134893] automatically matched to d1fapb_ |
PDB Entry: 2gaq (more details)
SCOPe Domain Sequences for d2gaqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gaqa1 a.24.7.1 (A:4-98) FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) {Human (Homo sapiens) [TaxId: 9606]} rvailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrd lmeaqewcrkymksgnvkdltqawdlyyhvfrris
Timeline for d2gaqa1: