SCOP 1.75: Domain d2gaqa1: 2gaq A:4-98

Lineage for d2gaqa1 (2gaq A:4-98)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family)

5. Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (1 protein)

6. Protein FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47214] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47215] (7 PDB entries)

8. Domain d2gaqa1: 2gaq A:4-98 [134893]
   automatically matched to d1fapb_

Details for d2gaqa1

PDB Entry: 2gaq

PDB Description: nmr solution structure of the frb domain of mtor

PDB Compounds: (A:) FKBP12-rapamycin complex-associated protein

SCOP Domain Sequences for d2gaqa1:

Sequence; same for both SEQRES and ATOM records:

>d2gaqa1 a.24.7.1 (A:4-98) FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) {Human (Homo sapiens) [TaxId: 9606]}
rvailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrd
lmeaqewcrkymksgnvkdltqawdlyyhvfrris

Timeline for d2gaqa1:

• d2gaqa1 first appeared in SCOP 1.73
  
• d2gaqa1 appears in SCOPe 2.01
  
• d2gaqa1 appears in the current release, SCOPe 2.08, called d2gaqa_