Lineage for d2gaqa1 (2gaq A:4-98)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 765515Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family) (S)
  5. 765516Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (1 protein)
  6. 765517Protein FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47214] (1 species)
  7. 765518Species Human (Homo sapiens) [TaxId:9606] [47215] (7 PDB entries)
  8. 765526Domain d2gaqa1: 2gaq A:4-98 [134893]
    automatically matched to d1fapb_

Details for d2gaqa1

PDB Entry: 2gaq (more details)

PDB Description: nmr solution structure of the frb domain of mtor
PDB Compounds: (A:) FKBP12-rapamycin complex-associated protein

SCOP Domain Sequences for d2gaqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gaqa1 a.24.7.1 (A:4-98) FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) {Human (Homo sapiens) [TaxId: 9606]}
rvailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrd
lmeaqewcrkymksgnvkdltqawdlyyhvfrris

SCOP Domain Coordinates for d2gaqa1:

Click to download the PDB-style file with coordinates for d2gaqa1.
(The format of our PDB-style files is described here.)

Timeline for d2gaqa1: