Lineage for d2gaob_ (2gao B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867872Protein SAR1 [69483] (3 species)
  7. 2867880Species Human (Homo sapiens) [TaxId:9606] [142223] (1 PDB entry)
    Uniprot Q9NR31 13-198
  8. 2867882Domain d2gaob_: 2gao B: [134892]
    automated match to d2gaoa1
    complexed with gdp, unx

Details for d2gaob_

PDB Entry: 2gao (more details), 2 Å

PDB Description: crystal structure of human sar1a in complex with gdp
PDB Compounds: (B:) GTP-binding protein SAR1a

SCOPe Domain Sequences for d2gaob_:

Sequence, based on SEQRES records: (download)

>d2gaob_ c.37.1.8 (B:) SAR1 {Human (Homo sapiens) [TaxId: 9606]}
svlqflglykksgklvflgldnagkttllhmlkddrlgqhvptlhptseeltiagmtftt
fdlggheqarrvwknylpaingivflvdcadhsrlveskvelnalmtdetisnvpililg
nkidrtdaiseeklreifglygqttgkgnvtlkelnarpmevfmcsvlkrqgygegfrwl
sqyid

Sequence, based on observed residues (ATOM records): (download)

>d2gaob_ c.37.1.8 (B:) SAR1 {Human (Homo sapiens) [TaxId: 9606]}
svlqflglykksgklvflgldnagkttllhmlkvptlhptseeltiagmtfttfdlrvwk
nylpaingivflvdcadhsrlveskvelnalmtdetisnvpililgnkidrtdaiseekl
reifglygqttgkgnvtlkelnarpmevfmcsvlkrqgygegfrwlsqyid

SCOPe Domain Coordinates for d2gaob_:

Click to download the PDB-style file with coordinates for d2gaob_.
(The format of our PDB-style files is described here.)

Timeline for d2gaob_: