Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein SAR1 [69483] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [142223] (1 PDB entry) Uniprot Q9NR31 13-198 |
Domain d2gaob_: 2gao B: [134892] automated match to d2gaoa1 complexed with gdp, unx |
PDB Entry: 2gao (more details), 2 Å
SCOPe Domain Sequences for d2gaob_:
Sequence, based on SEQRES records: (download)
>d2gaob_ c.37.1.8 (B:) SAR1 {Human (Homo sapiens) [TaxId: 9606]} svlqflglykksgklvflgldnagkttllhmlkddrlgqhvptlhptseeltiagmtftt fdlggheqarrvwknylpaingivflvdcadhsrlveskvelnalmtdetisnvpililg nkidrtdaiseeklreifglygqttgkgnvtlkelnarpmevfmcsvlkrqgygegfrwl sqyid
>d2gaob_ c.37.1.8 (B:) SAR1 {Human (Homo sapiens) [TaxId: 9606]} svlqflglykksgklvflgldnagkttllhmlkvptlhptseeltiagmtfttfdlrvwk nylpaingivflvdcadhsrlveskvelnalmtdetisnvpililgnkidrtdaiseekl reifglygqttgkgnvtlkelnarpmevfmcsvlkrqgygegfrwlsqyid
Timeline for d2gaob_: