Lineage for d2gaoa1 (2gao A:13-198)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2476031Protein SAR1 [69483] (3 species)
  7. 2476039Species Human (Homo sapiens) [TaxId:9606] [142223] (1 PDB entry)
    Uniprot Q9NR31 13-198
  8. 2476040Domain d2gaoa1: 2gao A:13-198 [134891]
    complexed with gdp, unx

Details for d2gaoa1

PDB Entry: 2gao (more details), 2 Å

PDB Description: crystal structure of human sar1a in complex with gdp
PDB Compounds: (A:) GTP-binding protein SAR1a

SCOPe Domain Sequences for d2gaoa1:

Sequence, based on SEQRES records: (download)

>d2gaoa1 c.37.1.8 (A:13-198) SAR1 {Human (Homo sapiens) [TaxId: 9606]}
ssvlqflglykksgklvflgldnagkttllhmlkddrlgqhvptlhptseeltiagmtft
tfdlggheqarrvwknylpaingivflvdcadhsrlveskvelnalmtdetisnvpilil
gnkidrtdaiseeklreifglygqttgkgnvtlkelnarpmevfmcsvlkrqgygegfrw
lsqyid

Sequence, based on observed residues (ATOM records): (download)

>d2gaoa1 c.37.1.8 (A:13-198) SAR1 {Human (Homo sapiens) [TaxId: 9606]}
ssvlqflglykksgklvflgldnagkttllhmltseeltiagmtfttfdlrvwknylpai
ngivflvdcadhsrlveskvelnalmtdetisnvpililgnkidrtdaiseeklreifgl
ygqttgkgnvtlkelnarpmevfmcsvlkrqgygegfrwlsqyid

SCOPe Domain Coordinates for d2gaoa1:

Click to download the PDB-style file with coordinates for d2gaoa1.
(The format of our PDB-style files is described here.)

Timeline for d2gaoa1: