Lineage for d2ganb_ (2gan B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533367Protein Hypothetical protein PH0736 [143666] (1 species)
  7. 2533368Species Pyrococcus horikoshii [TaxId:53953] [143667] (1 PDB entry)
    Uniprot O58467 1-182
  8. 2533370Domain d2ganb_: 2gan B: [134890]
    Other proteins in same PDB: d2gana2
    automated match to d2gana1
    complexed with edo, so4

Details for d2ganb_

PDB Entry: 2gan (more details), 2.1 Å

PDB Description: crystal structure of a putative acetyltransferase from pyrococcus horikoshii, northeast structural genomics target jr32.
PDB Compounds: (B:) 182aa long hypothetical protein

SCOPe Domain Sequences for d2ganb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ganb_ d.108.1.1 (B:) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]}
megvkkiknpstvkdellelmfriyrstngkypalewvkrkpnpndfngfrevyepflkf
rlsqefdelytyqkdnriigtialvykrikekgiwwvpeelmnekvglieffvvdpefqg
kgigstllefavkrlrslgkdpyvvtfpnleaysyyymkkgfreimrykefvilkfnhkk
f

SCOPe Domain Coordinates for d2ganb_:

Click to download the PDB-style file with coordinates for d2ganb_.
(The format of our PDB-style files is described here.)

Timeline for d2ganb_: