Lineage for d2gafa_ (2gaf A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129933Family c.66.1.25: mRNA cap methylase [88785] (3 protein domains)
  6. 2129978Protein automated matches [190302] (8 species)
    not a true protein
  7. 2129991Species Vaccinia virus [TaxId:10245] [187111] (2 PDB entries)
  8. 2129993Domain d2gafa_: 2gaf A: [134888]
    Other proteins in same PDB: d2gafd_
    automated match to d1vpt__

Details for d2gafa_

PDB Entry: 2gaf (more details), 2.4 Å

PDB Description: Crystal Structure of the Vaccinia Polyadenylate Polymerase Heterodimer (apo form)
PDB Compounds: (A:) Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase

SCOPe Domain Sequences for d2gafa_:

Sequence, based on SEQRES records: (download)

>d2gafa_ c.66.1.25 (A:) automated matches {Vaccinia virus [TaxId: 10245]}
mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgild
gatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeey
lrsikkqlhpskiilisdvasaaggnepstadllsnyalqnvmisilnpvasslkwrcpf
pdqwikdfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyyln
kivrnkvvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip

Sequence, based on observed residues (ATOM records): (download)

>d2gafa_ c.66.1.25 (A:) automated matches {Vaccinia virus [TaxId: 10245]}
mdvvsldkpfmyfeeidneldyepeskklpyqgqlklllgelfflsklqrhgildgatvv
yigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeeylrsik
kqlhpskiilisdvaspstadllsnyalqnvmisilnpvasslkwrcpfpdqwikdfyip
hgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyylnkivrnkvvvnf
dypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip

SCOPe Domain Coordinates for d2gafa_:

Click to download the PDB-style file with coordinates for d2gafa_.
(The format of our PDB-style files is described here.)

Timeline for d2gafa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gafd_