Class g: Small proteins [56992] (100 folds) |
Fold g.86: Coronavirus NSP10-like [144245] (1 superfamily) binds two zinc ion per subunit; forms a dodecameric shell |
Superfamily g.86.1: Coronavirus NSP10-like [144246] (1 family) automatically mapped to Pfam PF09401 |
Family g.86.1.1: Coronavirus NSP10-like [144247] (2 proteins) partly covered by PfamB PB001266 |
Protein Nonstructural protein 10, NSP10 [144248] (2 species) |
Species SARS coronavirus [TaxId:227859] [144249] (3 PDB entries) Uniprot P59641 4239-4359! Uniprot P59641 4240-4362 |
Domain d2ga6m_: 2ga6 M: [134873] automated match to d2g9ta1 complexed with zn |
PDB Entry: 2ga6 (more details), 2.7 Å
SCOPe Domain Sequences for d2ga6m_:
Sequence, based on SEQRES records: (download)
>d2ga6m_ g.86.1.1 (M:) Nonstructural protein 10, NSP10 {SARS coronavirus [TaxId: 227859]} anstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesf ggascclycrchidhpnpkgfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygc s
>d2ga6m_ g.86.1.1 (M:) Nonstructural protein 10, NSP10 {SARS coronavirus [TaxId: 227859]} anstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesf ggascclycrchidhpnfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygcs
Timeline for d2ga6m_: